Lineage for d2cpua2 (2cpu A:1-403)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474053Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 474087Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 474088Species Human (Homo sapiens) [TaxId:9606] [51460] (23 PDB entries)
  8. 474100Domain d2cpua2: 2cpu A:1-403 [63335]
    Other proteins in same PDB: d2cpua1

Details for d2cpua2

PDB Entry: 2cpu (more details), 2 Å

PDB Description: subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant

SCOP Domain Sequences for d2cpua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpua2 c.1.8.1 (A:1-403) Animal alpha-amylase {Human (Homo sapiens)}
eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhn
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdg

SCOP Domain Coordinates for d2cpua2:

Click to download the PDB-style file with coordinates for d2cpua2.
(The format of our PDB-style files is described here.)

Timeline for d2cpua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cpua1