Lineage for d2cpua1 (2cpu A:404-496)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2076899Protein Animal alpha-amylase [51024] (3 species)
  7. 2076900Species Human (Homo sapiens) [TaxId:9606] [51026] (53 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2076933Domain d2cpua1: 2cpu A:404-496 [63334]
    Other proteins in same PDB: d2cpua2
    complexed with ca, cl

Details for d2cpua1

PDB Entry: 2cpu (more details), 2 Å

PDB Description: subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2cpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpua1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d2cpua1:

Click to download the PDB-style file with coordinates for d2cpua1.
(The format of our PDB-style files is described here.)

Timeline for d2cpua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cpua2