SCOP 1.71: Domain d2cpua1: 2cpu A:404-496

Lineage for d2cpua1 (2cpu A:404-496)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (27 PDB entries)

8. Domain d2cpua1: 2cpu A:404-496 [63334]
   Other proteins in same PDB: d2cpua2
   complexed with ca, cl; mutant

Details for d2cpua1

PDB Entry: 2cpu, 2 Å

PDB Description: subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant

SCOP Domain Sequences for d2cpua1:

Sequence; same for both SEQRES and ATOM records:

>d2cpua1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d2cpua1:

• d2cpua1 first appeared in SCOP 1.57
  
• d2cpua1 appears in SCOP 1.69
  
• d2cpua1 appears in SCOP 1.73
  
• d2cpua1 appears in the current release, SCOPe 2.08