Lineage for d1qswd_ (1qsw D:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252220Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries)
  8. 252392Domain d1qswd_: 1qsw D: [63333]
    mutant

Details for d1qswd_

PDB Entry: 1qsw (more details), 1.85 Å

PDB Description: crystal structure analysis of a human lysozyme mutant w64c c65a
PDB Compounds: (D:)

SCOP Domain Sequences for d1qswd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qswd_ d.2.1.2 (D:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srycandgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1qswd_:

Click to download the PDB-style file with coordinates for d1qswd_.
(The format of our PDB-style files is described here.)

Timeline for d1qswd_: