Lineage for d1qjcb_ (1qjc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860494Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 2860500Domain d1qjcb_: 1qjc B: [63329]
    complexed with pns, so4

Details for d1qjcb_

PDB Entry: 1qjc (more details), 1.63 Å

PDB Description: phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1qjcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjcb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d1qjcb_:

Click to download the PDB-style file with coordinates for d1qjcb_.
(The format of our PDB-style files is described here.)

Timeline for d1qjcb_: