Lineage for d1qhqa_ (1qhq A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162497Protein Auracyanin [63686] (1 species)
  7. 162498Species Chloroflexus aurantiacus [63687] (1 PDB entry)
  8. 162499Domain d1qhqa_: 1qhq A: [63326]

Details for d1qhqa_

PDB Entry: 1qhq (more details), 1.55 Å

PDB Description: auracyanin, a blue copper protein from the green thermophilic photosynthetic bacterium chloroflexus aurantiacus

SCOP Domain Sequences for d1qhqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus}
anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl
vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi
ctfpghylagmkgtltvtp

SCOP Domain Coordinates for d1qhqa_:

Click to download the PDB-style file with coordinates for d1qhqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qhqa_: