Lineage for d1qg5a_ (1qg5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413784Protein beta-Lactoglobulin [50827] (4 species)
  7. 2413785Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries)
    Uniprot P02754
  8. 2413791Domain d1qg5a_: 1qg5 A: [63323]

Details for d1qg5a_

PDB Entry: 1qg5 (more details), 2 Å

PDB Description: high resolution crystal structure of the bovine beta-lactoglobulin (isoform a)
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d1qg5a_:

Sequence, based on SEQRES records: (download)

>d1qg5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnpt

Sequence, based on observed residues (ATOM records): (download)

>d1qg5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaeqslvcqcl
vrtpevddealekfdkalkalpmhirlsfnpt

SCOPe Domain Coordinates for d1qg5a_:

Click to download the PDB-style file with coordinates for d1qg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qg5a_: