Lineage for d1qg5a_ (1qg5 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62088Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 62089Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 62090Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins)
  6. 62103Protein beta-Lactoglobulin [50827] (2 species)
  7. 62104Species Cow (Bos taurus) [TaxId:9913] [50828] (11 PDB entries)
  8. 62108Domain d1qg5a_: 1qg5 A: [63323]

Details for d1qg5a_

PDB Entry: 1qg5 (more details), 2 Å

PDB Description: high resolution crystal structure of the bovine beta-lactoglobulin (isoform a)

SCOP Domain Sequences for d1qg5a_:

Sequence, based on SEQRES records: (download)

>d1qg5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnpt

Sequence, based on observed residues (ATOM records): (download)

>d1qg5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaeqslvcqcl
vrtpevddealekfdkalkalpmhirlsfnpt

SCOP Domain Coordinates for d1qg5a_:

Click to download the PDB-style file with coordinates for d1qg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qg5a_: