SCOPe 2.05: Domain d1jztb_: 1jzt B:

Lineage for d1jztb_ (1jzt B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest

4. Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families)
   possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)

5. Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins)

6. Protein Hypothetical protein YNL200c (YNU0_YEAST) [64155] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64156] (1 PDB entry)

8. Domain d1jztb_: 1jzt B: [63320]
   structural genomics
   complexed with cl

Details for d1jztb_

PDB Entry: 1jzt, 1.94 Å

PDB Description: crystal structure of yeast ynu0, ynl200c

PDB Compounds: (B:) Hypothetical 27.5 kDa protein in SPX19-GCR2 intergenic region

SCOPe Domain Sequences for d1jztb_:

Sequence; same for both SEQRES and ATOM records:

>d1jztb_ c.104.1.1 (B:) Hypothetical protein YNL200c (YNU0_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkvvssklaaeidkelmgpqigftlqqlmelagfsvaqavcrqfplrgktetekgkhvfv
iagpgnnggdglvcarhlklfgynpvvfypkrsertefykqlvhqlnffkvpvlsqdegn
wleylkpektlcivdaifgfsfkppmrepfkgiveelckvqniipivsvdvptgwdvdkg
pisqpsinpavlvsltvpkpcsshirenqtthyvggrfiprdfankfgfepfgyestdqi
lkl

Timeline for d1jztb_:

• d1jztb_ first appeared in SCOP 1.57
  
• d1jztb_ appears in SCOPe 2.04
  
• d1jztb_ appears in SCOPe 2.06
  
• d1jztb_ appears in the current release, SCOPe 2.08