Lineage for d1jztb_ (1jzt B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148372Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest
  4. 2148373Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) (S)
    possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)
  5. 2148374Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 protein domains)
  6. 2148398Protein Hypothetical protein YNL200c (YNU0_YEAST) [64155] (1 species)
  7. 2148399Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64156] (1 PDB entry)
  8. 2148401Domain d1jztb_: 1jzt B: [63320]
    structural genomics
    complexed with cl

Details for d1jztb_

PDB Entry: 1jzt (more details), 1.94 Å

PDB Description: Crystal structure of yeast ynu0, YNL200c
PDB Compounds: (B:) Hypothetical 27.5 kDa protein in SPX19-GCR2 intergenic region

SCOPe Domain Sequences for d1jztb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jztb_ c.104.1.1 (B:) Hypothetical protein YNL200c (YNU0_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkvvssklaaeidkelmgpqigftlqqlmelagfsvaqavcrqfplrgktetekgkhvfv
iagpgnnggdglvcarhlklfgynpvvfypkrsertefykqlvhqlnffkvpvlsqdegn
wleylkpektlcivdaifgfsfkppmrepfkgiveelckvqniipivsvdvptgwdvdkg
pisqpsinpavlvsltvpkpcsshirenqtthyvggrfiprdfankfgfepfgyestdqi
lkl

SCOPe Domain Coordinates for d1jztb_:

Click to download the PDB-style file with coordinates for d1jztb_.
(The format of our PDB-style files is described here.)

Timeline for d1jztb_: