SCOPe 2.07: Domain d1jxka1: 1jxk A:404-491

Lineage for d1jxka1 (1jxk A:404-491)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d1jxka1: 1jxk A:404-491 [63316]
   Other proteins in same PDB: d1jxka2
   complexed with ca, cl

Details for d1jxka1

PDB Entry: 1jxk, 1.9 Å

PDB Description: role of ethe mobile loop in the mehanism of human salivary amylase

PDB Compounds: (A:) Alpha-amylase, salivary

SCOPe Domain Sequences for d1jxka1:

Sequence; same for both SEQRES and ATOM records:

>d1jxka1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d1jxka1:

• d1jxka1 first appeared in SCOP 1.57
  
• d1jxka1 appears in SCOPe 2.06
  
• d1jxka1 appears in the current release, SCOPe 2.08