SCOP 1.65: Domain d1jxja1: 1jxj A:404-496

Lineage for d1jxja1 (1jxj A:404-496)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (18 PDB entries)

8. Domain d1jxja1: 1jxj A:404-496 [63314]
   Other proteins in same PDB: d1jxja2
   complexed with ca, cl; mutant

Details for d1jxja1

PDB Entry: 1jxj, 1.99 Å

PDB Description: role of mobile loop in the mechanism of human salivary amylase

SCOP Domain Sequences for d1jxja1:

Sequence; same for both SEQRES and ATOM records:

>d1jxja1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1jxja1:

• d1jxja1 first appeared in SCOP 1.57
  
• d1jxja1 appears in SCOP 1.63
  
• d1jxja1 appears in SCOP 1.67
  
• d1jxja1 appears in the current release, SCOPe 2.08