SCOPe 2.01: Domain d1jxda_: 1jxd A:

Lineage for d1jxda_ (1jxd A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [49519] (6 PDB entries)

8. Domain d1jxda_: 1jxd A: [63312]
   complexed with cu

Details for d1jxda_

PDB Entry: 1jxd

PDB Description: solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1jxda_:

Sequence; same for both SEQRES and ATOM records:

>d1jxda_ b.6.1.1 (A:) Plastocyanin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
lafaagesftstftepgtytyycephrgagmvgkvvvd

Timeline for d1jxda_:

• d1jxda_ first appeared in SCOP 1.57
  
• d1jxda_ appears in SCOP 1.75
  
• d1jxda_ appears in SCOPe 2.02
  
• d1jxda_ appears in the current release, SCOPe 2.08