Lineage for d1jw6a_ (1jw6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1779942Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 1779961Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (56 PDB entries)
    Uniprot P81461
  8. 1779985Domain d1jw6a_: 1jw6 A: [63309]
    complexed with a hexapeptide
    complexed with ca, ipa, mn, ptd

Details for d1jw6a_

PDB Entry: 1jw6 (more details), 1.93 Å

PDB Description: crystal structure of the complex of concanavalin a and hexapeptide
PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d1jw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jw6a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1jw6a_:

Click to download the PDB-style file with coordinates for d1jw6a_.
(The format of our PDB-style files is described here.)

Timeline for d1jw6a_: