SCOP 1.65: Domain d1jw6a_: 1jw6 A:

Lineage for d1jw6a_ (1jw6 A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond,whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (45 PDB entries)

8. Domain d1jw6a_: 1jw6 A: [63309]
   complexed with a hexapeptide
   complexed with ca, ipa, mn, ptd

Details for d1jw6a_

PDB Entry: 1jw6, 1.93 Å

PDB Description: crystal structure of the complex of concanavalin a and hexapeptide

SCOP Domain Sequences for d1jw6a_:

Sequence; same for both SEQRES and ATOM records:

>d1jw6a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1jw6a_:

• d1jw6a_ first appeared in SCOP 1.57
  
• d1jw6a_ appears in SCOP 1.63
  
• d1jw6a_ appears in SCOP 1.67
  
• d1jw6a_ appears in the current release, SCOPe 2.08