SCOPe 2.05: Domain d1jv0b_: 1jv0 B:

Lineage for d1jv0b_ (1jv0 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)

8. Domain d1jv0b_: 1jv0 B: [63304]
   complexed with cl, edo, zn

Details for d1jv0b_

PDB Entry: 1jv0, 2 Å

PDB Description: the crystal structure of the zinc(ii) adduct of the cai michigan 1 variant

PDB Compounds: (B:) carbonic anhydrase I

SCOPe Domain Sequences for d1jv0b_:

Sequence; same for both SEQRES and ATOM records:

>d1jv0b_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d1jv0b_:

• d1jv0b_ first appeared in SCOP 1.57
  
• d1jv0b_ appears in SCOPe 2.04
  
• d1jv0b_ appears in SCOPe 2.06
  
• d1jv0b_ appears in the current release, SCOPe 2.08