Lineage for d1jv0a_ (1jv0 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566493Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 566494Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 566495Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 566496Protein Carbonic anhydrase [51071] (10 species)
  7. 566502Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries)
  8. 566509Domain d1jv0a_: 1jv0 A: [63303]

Details for d1jv0a_

PDB Entry: 1jv0 (more details), 2 Å

PDB Description: the crystal structure of the zinc(ii) adduct of the cai michigan 1 variant

SCOP Domain Sequences for d1jv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

SCOP Domain Coordinates for d1jv0a_:

Click to download the PDB-style file with coordinates for d1jv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jv0a_: