Lineage for d1jujd_ (1juj D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212254Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2212311Domain d1jujd_: 1juj D: [63300]
    complexed with lya, ump

Details for d1jujd_

PDB Entry: 1juj (more details), 3 Å

PDB Description: human thymidylate synthase bound to dump and ly231514, a pyrrolo(2,3- d)pyrimidine-based antifolate
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d1jujd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jujd_ d.117.1.1 (D:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
hgelqylgqiqhilrcgvekddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d1jujd_:

Click to download the PDB-style file with coordinates for d1jujd_.
(The format of our PDB-style files is described here.)

Timeline for d1jujd_: