Lineage for d1juja_ (1juj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972355Species Human (Homo sapiens) [TaxId:9606] [55840] (47 PDB entries)
  8. 2972462Domain d1juja_: 1juj A: [63297]
    complexed with lya, ump

Details for d1juja_

PDB Entry: 1juj (more details), 3 Å

PDB Description: human thymidylate synthase bound to dump and ly231514, a pyrrolo(2,3- d)pyrimidine-based antifolate
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1juja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juja_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
hgelqylgqiqhilrcgvekddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d1juja_:

Click to download the PDB-style file with coordinates for d1juja_.
(The format of our PDB-style files is described here.)

Timeline for d1juja_: