Lineage for d1ju6d_ (1ju6 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578916Species Human (Homo sapiens) [TaxId:9606] [55840] (42 PDB entries)
  8. 2578977Domain d1ju6d_: 1ju6 D: [63292]
    complexed with lya, po4, ump

Details for d1ju6d_

PDB Entry: 1ju6 (more details), 2.89 Å

PDB Description: human thymidylate synthase complex with dump and ly231514, a pyrrolo(2,3-d)pyrimidine-based antifolate
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d1ju6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju6d_ d.117.1.1 (D:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
hgelqylgqiqhilrcgvekddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d1ju6d_:

Click to download the PDB-style file with coordinates for d1ju6d_.
(The format of our PDB-style files is described here.)

Timeline for d1ju6d_: