Lineage for d1ju6c_ (1ju6 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1923827Protein Thymidylate synthase [55833] (7 species)
  7. 1923962Species Human (Homo sapiens) [TaxId:9606] [55840] (24 PDB entries)
  8. 1924008Domain d1ju6c_: 1ju6 C: [63291]
    complexed with lya, po4, ump

Details for d1ju6c_

PDB Entry: 1ju6 (more details), 2.89 Å

PDB Description: human thymidylate synthase complex with dump and ly231514, a pyrrolo(2,3-d)pyrimidine-based antifolate
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d1ju6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju6c_ d.117.1.1 (C:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
hgelqylgqiqhilrcgvekddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d1ju6c_:

Click to download the PDB-style file with coordinates for d1ju6c_.
(The format of our PDB-style files is described here.)

Timeline for d1ju6c_: