Lineage for d1ju6c_ (1ju6 C:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (44 PDB entries) 
Domain d1ju6c_: 1ju6 C: [63291]
Details for d1ju6c_
PDB Entry: 1ju6 (more details), 2.89 Å
PDB Description: human thymidylate synthase complex with dump and ly231514, a pyrrolo(2,3-d)pyrimidine-based antifolate
SCOP Domain Sequences for d1ju6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ju6c_ d.117.1.1 (C:) Thymidylate synthase {Escherichia coli}
hgelqylgqiqhilrcgvekddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav
SCOP Domain Coordinates for d1ju6c_:
Click to download the PDB-style file with coordinates for d1ju6c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ju6c_:
- d1ju6c_ is new in SCOP 1.57
- d1ju6c_ appears in SCOP 1.59
- d1ju6c_ appears in the current release, SCOPe 2.08
View in 3D
