Lineage for d1jtzz_ (1jtz Z:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777375Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 2777376Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries)
  8. 2777387Domain d1jtzz_: 1jtz Z: [63288]

Details for d1jtzz_

PDB Entry: 1jtz (more details), 2.6 Å

PDB Description: crystal structure of trance/rankl cytokine.
PDB Compounds: (Z:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d1jtzz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtzz_ b.22.1.1 (Z:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
lrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOPe Domain Coordinates for d1jtzz_:

Click to download the PDB-style file with coordinates for d1jtzz_.
(The format of our PDB-style files is described here.)

Timeline for d1jtzz_: