Lineage for d1jtib_ (1jti B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568278Protein Ovalbumin [56578] (1 species)
  7. 2568279Species Chicken (Gallus gallus) [TaxId:9031] [56579] (3 PDB entries)
  8. 2568289Domain d1jtib_: 1jti B: [63281]
    mutant

Details for d1jtib_

PDB Entry: 1jti (more details), 2.3 Å

PDB Description: Loop-inserted Structure of P1-P1' Cleaved Ovalbumin Mutant R339T
PDB Compounds: (B:) Ovalbumin

SCOPe Domain Sequences for d1jtib_:

Sequence, based on SEQRES records: (download)

>d1jtib_ e.1.1.1 (B:) Ovalbumin {Chicken (Gallus gallus) [TaxId: 9031]}
gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
kglwektfkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtms
mlvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmam
gitdvfsssanlsgissaeslkisqavhaahaeineagtevvgsaeagvdaasvseefra
dhpflfcikhiatnavlffgrcvsp

Sequence, based on observed residues (ATOM records): (download)

>d1jtib_ e.1.1.1 (B:) Ovalbumin {Chicken (Gallus gallus) [TaxId: 9031]}
gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
klpgfgdsieaqcgtsvnvhsslrdilnqitkndvysfslasrlyaeerypilpeylqcv
kelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivfk
glwektfkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtmsm
lvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmamg
itdvfsssanlsgissaeslkisqavhaahaeineagtevvgsaeagvdaaeefradhpf
lfcikhiatnavlffgrcvsp

SCOPe Domain Coordinates for d1jtib_:

Click to download the PDB-style file with coordinates for d1jtib_.
(The format of our PDB-style files is described here.)

Timeline for d1jtib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jtia_