Lineage for d1jsna_ (1jsn A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57292Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 57293Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 57323Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 57324Protein Hemagglutinin [49824] (1 species)
  7. 57325Species Influenza A virus, different strains [TaxId:11320] [49825] (24 PDB entries)
  8. 57332Domain d1jsna_: 1jsn A: [63266]
    Other proteins in same PDB: d1jsnb_

Details for d1jsna_

PDB Entry: 1jsn (more details), 2.4 Å

PDB Description: structure of avian h5 haemagglutinin complexed with lsta receptro analog

SCOP Domain Sequences for d1jsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsna_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsvagw
llgnpmcdeflnvpewsyivekdnpvnglcypenfndyeelkhllsstnhfekiriiprs
swsnhdassgvssacpyngrssffrnvvwlikknnayptikrsynntnqedllilwgihh
pndaaeqtklyqnpttyvsvgtstlnqrsvpeiatrpkvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkggsaimksgleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksgrlvlatglrnvp

SCOP Domain Coordinates for d1jsna_:

Click to download the PDB-style file with coordinates for d1jsna_.
(The format of our PDB-style files is described here.)

Timeline for d1jsna_: