Lineage for d1jsmb_ (1jsm B:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 753258Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 753259Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 753260Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 753261Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 753262Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 753270Domain d1jsmb_: 1jsm B: [63265]
    Other proteins in same PDB: d1jsma_
    complexed with nag

Details for d1jsmb_

PDB Entry: 1jsm (more details), 1.9 Å

PDB Description: structure of h5 avian haemagglutinin
PDB Compounds: (B:) haemagglutinin (ha2 chain)

SCOP Domain Sequences for d1jsmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgttnkvnsiidkmn
tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydyp

SCOP Domain Coordinates for d1jsmb_:

Click to download the PDB-style file with coordinates for d1jsmb_.
(The format of our PDB-style files is described here.)

Timeline for d1jsmb_: