Lineage for d1jsib_ (1jsi B:)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1069044Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1069045Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1069046Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1069047Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1069048Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 1069058Domain d1jsib_: 1jsi B: [63263]
    Other proteins in same PDB: d1jsia_
    complexed with nag

Details for d1jsib_

PDB Entry: 1jsi (more details), 2.4 Å

PDB Description: crystal structure of h9 haemagglutinin bound to lstc receptor analog
PDB Compounds: (B:) haemagglutinin (ha2 chain)

SCOPe Domain Sequences for d1jsib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsib_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwpglvagwygfqhsndqgvgmaadsdstqkaidkitskvnnivdkmn
kqygiidhefseietrlnminnkiddqiqdiwtynaellvllenqktldehdanvnnlyn
kvkralgsnamedgkgcfelyhkcddqcmetirngtynrr

SCOPe Domain Coordinates for d1jsib_:

Click to download the PDB-style file with coordinates for d1jsib_.
(The format of our PDB-style files is described here.)

Timeline for d1jsib_: