SCOP 1.57: Domain d1jsha_: 1jsh A:

Lineage for d1jsha_ (1jsh A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)

5. Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)

6. Protein Hemagglutinin [49824] (1 species)

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (24 PDB entries)

8. Domain d1jsha_: 1jsh A: [63260]
   Other proteins in same PDB: d1jshb_

Details for d1jsha_

PDB Entry: 1jsh, 2.4 Å

PDB Description: crystal structure of h9 haemagglutinin complexed with lsta receptor analog

SCOP Domain Sequences for d1jsha_:

Sequence; same for both SEQRES and ATOM records:

>d1jsha_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
dkicigyqstnstetvdtltetnvpvthakellhtshngmlcatnlghplildtctiegl
iygnpscdlllggrewsyiverpsavngmcypgnvenleelrslfssassyqriqifpdt
iwnvsysgtssacsdsfyrsmrwltqknnaypiqdaqytnnrgksilfmwginhpptdtv
qtnlytrtdtttsvttedinrtfkpvigprplvnglhgridyywsvlkpgqtlrvrsngn
liapwyghilsgeshgrilktdlnsgncvvqcqtergglnttlpfhnvskyafgncpkyv
gvkslklavglrnvpar

Timeline for d1jsha_:

• d1jsha_ is new in SCOP 1.57
  
• d1jsha_ appears in SCOP 1.59
  
• d1jsha_ appears in the current release, SCOPe 2.08