Lineage for d1jsdb_ (1jsd B:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 626649Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 626650Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 626651Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 626652Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 626653Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 626654Domain d1jsdb_: 1jsd B: [63259]
    Other proteins in same PDB: d1jsda_
    complexed with nag, po4

Details for d1jsdb_

PDB Entry: 1jsd (more details), 1.8 Å

PDB Description: crystal structure of swine h9 haemagglutinin

SCOP Domain Sequences for d1jsdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsdb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwpglvagwygfqhsndqgvgmaadsdstqkaidkitskvnnivdkmn
kqygiidhefseietrlnminnkiddqiqdiwtynaellvllenqktldehdanvnnlyn
kvkralgsnamedgkgcfelyhkcddqcmetirngtynrr

SCOP Domain Coordinates for d1jsdb_:

Click to download the PDB-style file with coordinates for d1jsdb_.
(The format of our PDB-style files is described here.)

Timeline for d1jsdb_: