Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (1 protein) |
Protein Gab protein (hypothetical protein YgaT) [63856] (1 species) unknown function |
Species Escherichia coli [TaxId:562] [63857] (1 PDB entry) |
Domain d1jr7a_: 1jr7 A: [63255] complexed with fe2 |
PDB Entry: 1jr7 (more details), 2 Å
SCOP Domain Sequences for d1jr7a_:
Sequence, based on SEQRES records: (download)
>d1jr7a_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli [TaxId: 562]} gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld dwehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf ayasnhyqthq
>d1jr7a_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli [TaxId: 562]} gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy yarfvvknvylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehl dnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwl selsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasn hyqthq
Timeline for d1jr7a_: