Lineage for d1jr7a_ (1jr7 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115107Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 115174Superfamily b.82.2: Clavaminate synthase-like [51197] (4 families) (S)
  5. 115210Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (1 protein)
  6. 115211Protein Gab protein (hypothetical protein YgaT) [63856] (1 species)
  7. 115212Species Escherichia coli [TaxId:562] [63857] (1 PDB entry)
  8. 115213Domain d1jr7a_: 1jr7 A: [63255]

Details for d1jr7a_

PDB Entry: 1jr7 (more details), 2 Å

PDB Description: crystal structure of gab reveals oxidoreductase fold

SCOP Domain Sequences for d1jr7a_:

Sequence, based on SEQRES records: (download)

>d1jr7a_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli}
gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl
canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy
yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld
dwehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe
egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf
ayasnhyqthq

Sequence, based on observed residues (ATOM records): (download)

>d1jr7a_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli}
gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl
canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy
yarfvvknvylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehl
dnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwl
selsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasn
hyqthq

SCOP Domain Coordinates for d1jr7a_:

Click to download the PDB-style file with coordinates for d1jr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jr7a_: