Lineage for d1jr7a_ (1jr7 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070873Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 protein domains)
    automatically mapped to Pfam PF08943
  6. 2070874Protein Gab protein (hypothetical protein YgaT) [63856] (1 species)
    unknown function
  7. 2070875Species Escherichia coli [TaxId:562] [63857] (2 PDB entries)
  8. 2070876Domain d1jr7a_: 1jr7 A: [63255]
    complexed with fe2

Details for d1jr7a_

PDB Entry: 1jr7 (more details), 2 Å

PDB Description: crystal structure of gab reveals oxidoreductase fold
PDB Compounds: (A:) hypothetical 37.4 kda protein in iley-gabd intergenic region

SCOPe Domain Sequences for d1jr7a_:

Sequence, based on SEQRES records: (download)

>d1jr7a_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli [TaxId: 562]}
gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl
canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy
yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld
dwehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe
egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf
ayasnhyqthq

Sequence, based on observed residues (ATOM records): (download)

>d1jr7a_ b.82.2.3 (A:) Gab protein (hypothetical protein YgaT) {Escherichia coli [TaxId: 562]}
gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddl
canqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqy
yarfvvknvylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehl
dnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwl
selsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasn
hyqthq

SCOPe Domain Coordinates for d1jr7a_:

Click to download the PDB-style file with coordinates for d1jr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jr7a_: