Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (14 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species) contains additional alpha-helical domain after the family specific domains |
Species Escherichia coli [TaxId:562] [52712] (2 PDB entries) |
Domain d1jr3e2: 1jr3 E:1-207 [63254] Other proteins in same PDB: d1jr3a1, d1jr3a2, d1jr3b1, d1jr3b2, d1jr3c1, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1 complexed with so4, zn |
PDB Entry: 1jr3 (more details), 2.7 Å
SCOP Domain Sequences for d1jr3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr3e2 c.37.1.20 (E:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli} mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev tmsqdallaalrlsagspgaalalfqg
Timeline for d1jr3e2: