SCOP 1.63: Domain d1jr3e2: 1jr3 E:1-207

Lineage for d1jr3e2 (1jr3 E:1-207)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (14 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Escherichia coli [TaxId:562] [52712] (2 PDB entries)

8. Domain d1jr3e2: 1jr3 E:1-207 [63254]
   Other proteins in same PDB: d1jr3a1, d1jr3a2, d1jr3b1, d1jr3b2, d1jr3c1, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1
   complexed with so4, zn

Details for d1jr3e2

PDB Entry: 1jr3, 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii

SCOP Domain Sequences for d1jr3e2:

Sequence; same for both SEQRES and ATOM records:

>d1jr3e2 c.37.1.20 (E:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

Timeline for d1jr3e2:

• d1jr3e2 first appeared in SCOP 1.57
  
• d1jr3e2 appears in SCOP 1.61
  
• d1jr3e2 appears in SCOP 1.65
  
• d1jr3e2 appears in the current release, SCOPe 2.08