Lineage for d1jr3e2 (1jr3 E:1-207)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70268Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
  7. 70269Species Escherichia coli [TaxId:562] [52712] (2 PDB entries)
  8. 70271Domain d1jr3e2: 1jr3 E:1-207 [63254]
    Other proteins in same PDB: d1jr3a1, d1jr3a2, d1jr3b1, d1jr3b2, d1jr3c1, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1

Details for d1jr3e2

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (E:)

SCOP Domain Sequences for d1jr3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3e2 c.37.1.13 (E:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

SCOP Domain Coordinates for d1jr3e2:

Click to download the PDB-style file with coordinates for d1jr3e2.
(The format of our PDB-style files is described here.)

Timeline for d1jr3e2: