Lineage for d1jr3e1 (1jr3 E:208-334)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215613Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 215614Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 215615Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (4 proteins)
    contains an extra helix
  6. 215616Protein delta prime subunit [48021] (1 species)
  7. 215617Species Escherichia coli [TaxId:562] [48022] (2 PDB entries)
  8. 215619Domain d1jr3e1: 1jr3 E:208-334 [63253]
    Other proteins in same PDB: d1jr3a1, d1jr3a2, d1jr3b1, d1jr3b2, d1jr3c1, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e2
    complexed with so4, zn

Details for d1jr3e1

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii

SCOP Domain Sequences for d1jr3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3e1 a.80.1.1 (E:208-334) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

SCOP Domain Coordinates for d1jr3e1:

Click to download the PDB-style file with coordinates for d1jr3e1.
(The format of our PDB-style files is described here.)

Timeline for d1jr3e1: