![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) ![]() |
![]() | Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins) |
![]() | Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64032] (1 PDB entry) |
![]() | Domain d1jr3c2: 1jr3 C:3-242 [63250] Other proteins in same PDB: d1jr3a1, d1jr3b1, d1jr3c1, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2 |
PDB Entry: 1jr3 (more details), 2.7 Å
SCOP Domain Sequences for d1jr3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr3c2 c.37.1.13 (C:3-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli} yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
Timeline for d1jr3c2: