Lineage for d1jr3c1 (1jr3 C:243-368)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154555Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
  4. 154556Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
  5. 154557Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (4 proteins)
  6. 154567Protein gamma subunit [63578] (1 species)
  7. 154568Species Escherichia coli [TaxId:562] [63579] (1 PDB entry)
  8. 154571Domain d1jr3c1: 1jr3 C:243-368 [63249]
    Other proteins in same PDB: d1jr3a2, d1jr3b2, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2

Details for d1jr3c1

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (C:)

SCOP Domain Sequences for d1jr3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3c1 a.80.1.1 (C:243-368) gamma subunit {Escherichia coli}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOP Domain Coordinates for d1jr3c1:

Click to download the PDB-style file with coordinates for d1jr3c1.
(The format of our PDB-style files is described here.)

Timeline for d1jr3c1: