SCOPe 2.08: Domain d1jr3c1: 1jr3 C:243-368

Lineage for d1jr3c1 (1jr3 C:243-368)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein gamma subunit [63578] (2 species)

7. Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
   Uniprot P06710 5-368

8. Domain d1jr3c1: 1jr3 C:243-368 [63249]
   Other proteins in same PDB: d1jr3a2, d1jr3b2, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2
   protein/DNA complex; complexed with so4, zn

Details for d1jr3c1

PDB Entry: 1jr3, 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii

PDB Compounds: (C:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1jr3c1:

Sequence; same for both SEQRES and ATOM records:

>d1jr3c1 a.80.1.1 (C:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

Timeline for d1jr3c1:

• d1jr3c1 first appeared in SCOP 1.57
  
• d1jr3c1 appears in SCOPe 2.07