Lineage for d1jr3b2 (1jr3 B:4-242)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485481Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 485538Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species)
  7. 485539Species Escherichia coli [TaxId:562] [64032] (1 PDB entry)
  8. 485541Domain d1jr3b2: 1jr3 B:4-242 [63248]
    Other proteins in same PDB: d1jr3a1, d1jr3b1, d1jr3c1, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2

Details for d1jr3b2

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii

SCOP Domain Sequences for d1jr3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3b2 c.37.1.20 (B:4-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli}
qvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgln
cetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvy
lidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqi
rhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

SCOP Domain Coordinates for d1jr3b2:

Click to download the PDB-style file with coordinates for d1jr3b2.
(The format of our PDB-style files is described here.)

Timeline for d1jr3b2: