Class a: All alpha proteins [46456] (290 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein gamma subunit [63578] (2 species) |
Species Escherichia coli [TaxId:562] [63579] (3 PDB entries) Uniprot P06710 5-368 |
Domain d1jr3b1: 1jr3 B:243-368 [63247] Other proteins in same PDB: d1jr3a2, d1jr3b2, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2 protein/DNA complex; complexed with so4, zn |
PDB Entry: 1jr3 (more details), 2.7 Å
SCOPe Domain Sequences for d1jr3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr3b1 a.80.1.1 (B:243-368) gamma subunit {Escherichia coli [TaxId: 562]} tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr mplpep
Timeline for d1jr3b1: