Lineage for d1jr3a2 (1jr3 A:3-242)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180208Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species)
  7. 180209Species Escherichia coli [TaxId:562] [64032] (1 PDB entry)
  8. 180210Domain d1jr3a2: 1jr3 A:3-242 [63246]
    Other proteins in same PDB: d1jr3a1, d1jr3b1, d1jr3c1, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2

Details for d1jr3a2

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii

SCOP Domain Sequences for d1jr3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3a2 c.37.1.13 (A:3-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli}
yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

SCOP Domain Coordinates for d1jr3a2:

Click to download the PDB-style file with coordinates for d1jr3a2.
(The format of our PDB-style files is described here.)

Timeline for d1jr3a2: