Lineage for d1jr3a1 (1jr3 A:243-368)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274707Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 1274708Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 1274709Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 1274727Protein gamma subunit [63578] (2 species)
  7. 1274728Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
    Uniprot P06710 5-368
  8. 1274729Domain d1jr3a1: 1jr3 A:243-368 [63245]
    Other proteins in same PDB: d1jr3a2, d1jr3b2, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2
    protein/DNA complex; complexed with so4, zn

Details for d1jr3a1

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (A:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1jr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3a1 a.80.1.1 (A:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOPe Domain Coordinates for d1jr3a1:

Click to download the PDB-style file with coordinates for d1jr3a1.
(The format of our PDB-style files is described here.)

Timeline for d1jr3a1: