Lineage for d1jr3a1 (1jr3 A:243-368)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644559Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 644560Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 644561Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 644579Protein gamma subunit [63578] (2 species)
  7. 644580Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
  8. 644581Domain d1jr3a1: 1jr3 A:243-368 [63245]
    Other proteins in same PDB: d1jr3a2, d1jr3b2, d1jr3c2, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2

Details for d1jr3a1

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (A:) DNA polymerase III subunit gamma

SCOP Domain Sequences for d1jr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3a1 a.80.1.1 (A:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOP Domain Coordinates for d1jr3a1:

Click to download the PDB-style file with coordinates for d1jr3a1.
(The format of our PDB-style files is described here.)

Timeline for d1jr3a1: