Lineage for d1jr1b1 (1jr1 B:11-112,B:233-514)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080659Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [63902] (1 PDB entry)
  8. 2080661Domain d1jr1b1: 1jr1 B:11-112,B:233-514 [63244]
    Other proteins in same PDB: d1jr1a4
    contains two CBS domains inserted into the common fold, residues 113-232
    complexed with imp, k, moa

Details for d1jr1b1

PDB Entry: 1jr1 (more details), 2.6 Å

PDB Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid
PDB Compounds: (B:) Inosine-5'-monophosphate dehydrogenase 2

SCOPe Domain Sequences for d1jr1b1:

Sequence, based on SEQRES records: (download)

>d1jr1b1 c.1.5.1 (B:11-112,B:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
syvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspm
dtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqXyplaskdakkqllcgaa
igtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqviggnvvtaaq
aknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpviadggiqn
vghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamdkhlssqnr
yfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelk
fekrtssaqveggvhslhsyekrlf

Sequence, based on observed residues (ATOM records): (download)

>d1jr1b1 c.1.5.1 (B:11-112,B:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
syvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspm
dtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqXyplaskdakkqllcgaa
igtheddkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqviggnvvtaaq
aknlidagvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpviadggiqn
vghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamikvaqgvsg
avqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaqveggvhs
lhsyekrlf

SCOPe Domain Coordinates for d1jr1b1:

Click to download the PDB-style file with coordinates for d1jr1b1.
(The format of our PDB-style files is described here.)

Timeline for d1jr1b1: