SCOP 1.73: Domain d1jr1a3: 1jr1 A:178-232

Lineage for d1jr1a3 (1jr1 A:178-232)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (10 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [64260] (1 PDB entry)

8. Domain d1jr1a3: 1jr1 A:178-232 [63243]
   Other proteins in same PDB: d1jr1a1, d1jr1b1
   complexed with imp, k, moa

Details for d1jr1a3

PDB Entry: 1jr1, 2.6 Å

PDB Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid

PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase 2

SCOP Domain Sequences for d1jr1a3:

Sequence, based on SEQRES records:

>d1jr1a3 d.37.1.1 (A:178-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
imtkredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrd

Sequence, based on observed residues (ATOM records):

>d1jr1a3 d.37.1.1 (A:178-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
imtkredlvvapagitlkeaneilqrsklpivnendelvaiiartdlkknrd

Timeline for d1jr1a3:

• d1jr1a3 first appeared in SCOP 1.57
  
• d1jr1a3 appears in SCOP 1.71
  
• d1jr1a3 does not appear in SCOP 1.75