Lineage for d1jr1a3 (1jr1 A:178-232)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502537Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502538Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 502539Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 502554Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 502555Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [64260] (1 PDB entry)
  8. 502557Domain d1jr1a3: 1jr1 A:178-232 [63243]
    Other proteins in same PDB: d1jr1a1, d1jr1b1

Details for d1jr1a3

PDB Entry: 1jr1 (more details), 2.6 Å

PDB Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid

SCOP Domain Sequences for d1jr1a3:

Sequence, based on SEQRES records: (download)

>d1jr1a3 d.37.1.1 (A:178-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus)}
imtkredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrd

Sequence, based on observed residues (ATOM records): (download)

>d1jr1a3 d.37.1.1 (A:178-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus)}
imtkredlvvapagitlkeaneilqrsklpivnendelvaiiartdlkknrd

SCOP Domain Coordinates for d1jr1a3:

Click to download the PDB-style file with coordinates for d1jr1a3.
(The format of our PDB-style files is described here.)

Timeline for d1jr1a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jr1b1