Lineage for d1jr1a2 (1jr1 A:113-155)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79329Fold d.37: CBS-domain [54630] (1 superfamily)
  4. 79330Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 79331Family d.37.1.1: CBS-domain [54632] (1 protein)
  6. 79332Protein Type II inosine monophosphate dehydrogenase [54633] (3 species)
  7. 79333Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [64260] (1 PDB entry)
  8. 79334Domain d1jr1a2: 1jr1 A:113-155 [63242]
    Other proteins in same PDB: d1jr1a1, d1jr1b1

Details for d1jr1a2

PDB Entry: 1jr1 (more details), 2.6 Å

PDB Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid

SCOP Domain Sequences for d1jr1a2:

Sequence, based on SEQRES records: (download)

>d1jr1a2 d.37.1.1 (A:113-155) Type II inosine monophosphate dehydrogenase {Chinese hamster (Cricetulus griseus)}
gfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlv

Sequence, based on observed residues (ATOM records): (download)

>d1jr1a2 d.37.1.1 (A:113-155) Type II inosine monophosphate dehydrogenase {Chinese hamster (Cricetulus griseus)}
gfitdpvvdrvrfeakmgsrlv

SCOP Domain Coordinates for d1jr1a2:

Click to download the PDB-style file with coordinates for d1jr1a2.
(The format of our PDB-style files is described here.)

Timeline for d1jr1a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jr1b1