Lineage for d1jr1a1 (1jr1 A:17-112,A:233-514)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384178Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 384179Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 384180Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)
  7. 384181Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [63902] (1 PDB entry)
  8. 384182Domain d1jr1a1: 1jr1 A:17-112,A:233-514 [63241]
    Other proteins in same PDB: d1jr1a2, d1jr1a3

Details for d1jr1a1

PDB Entry: 1jr1 (more details), 2.6 Å

PDB Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid

SCOP Domain Sequences for d1jr1a1:

Sequence, based on SEQRES records: (download)

>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus)}
gltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspmdtvtea
gmaiamaltggigfihhnctpefqanevrkvkkyeqXyplaskdakkqllcgaaigthed
dkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqviggnvvtaaqaknlid
agvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpviadggiqnvghiak
alalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamdkhlssqnryfsead
kikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrts
saqveggvhslhsyekrlf

Sequence, based on observed residues (ATOM records): (download)

>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus)}
gltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvsspmdtvtea
gmaiamaltggigfihhnctpefqanevrkvkkyeqXyplaskdakkqllcgaaigthed
dkyrldllalagvdvvvldssqgnsifqinmikymkekypnlqviggnvvtaaqaknlid
agvdalrvgmgcgsicitqevlacgrpqatavykvseyarrfgvpviadggiqnvghiak
alalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldamikvaqgvsgavqdkg
sihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaqveggvhslhsyek
rlf

SCOP Domain Coordinates for d1jr1a1:

Click to download the PDB-style file with coordinates for d1jr1a1.
(The format of our PDB-style files is described here.)

Timeline for d1jr1a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jr1b1