Lineage for d1jqsc_ (1jqs C:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. Protein 70S ribosome functional complex [58121] (2 species)
  7. Species Escherichia coli [TaxId:562] [58123] (5 PDB entries)
  8. Domain d1jqsc_: 1jqs C: [63239]

Details for d1jqsc_

PDB Entry: 1jqs (more details)

PDB Description: Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of E. coli 70S ribosome bound with EF-G and GMPPCP, a nonhydrolysable GTP analog

SCOP Domain Sequences for d1jqsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqsc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli}
mrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqg
rgsfvmff

SCOP Domain Coordinates for d1jqsc_ are not available.

Timeline for d1jqsc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jqsa_, d1jqsb_