Lineage for d1jqmb_ (1jqm B:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627317Domain d1jqmb_: 1jqm B: [63236]
    Fitting of L11 protein and elongation factor G (EF-G) in the cryo-EM map

Details for d1jqmb_

PDB Entry: 1jqm (more details)

PDB Description: Fitting of L11 protein and elongation factor G (EF-G) in the cryo-em map of e. coli 70S ribosome bound with EF-G, GDP and fusidic acid

SCOP Domain Sequences for d1jqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqmb_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli}
mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
lrmkaytygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeeptee
elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
sktqgrgsfvmffdhyqevpkqvqeklikgq

SCOP Domain Coordinates for d1jqmb_:

Click to download the PDB-style file with coordinates for d1jqmb_.
(The format of our PDB-style files is described here.)

Timeline for d1jqmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jqma_